technical analysis


IP address

IP address:
Country: United States


HTTP/1.1 200 OK
Date: Mon, 29 Feb 2016 00:55:51 GMT
Server: Apache/2.4.7 (Ubuntu)
Last-Modified: Mon, 21 Dec 2015 16:21:54 GMT
ETag: "1354-5276ae32abbf4"
Accept-Ranges: bytes
Content-Length: 4948
Vary: Accept-Encoding
Content-Type: text/html

Basic information about

Domain name length 36
Domain name length without TLD 32
TLD com
Abuse contact abuse [at]
Reverse order moc.sriadapiwenyawagnivigsiyllekpihc
Sha256 Hash 58adc20b6bd45d343642c9228d721e5227822c6f8158912274516a06230d9ca5
Domain MD5 Hash 455b563db90642cde1e8af6374764b1e
Soundex C124


Registry Domain ID 1962798591_DOMAIN_COM-VRSN
Registrar WHOIS Server
Registrar URL
Updated Date 2015-09-23T08:46:41.00Z
Creation Date 2015-09-23T15:46:00.00Z
Registrar Registration Expiration Date 2016-09-23T15:46:00.00Z
Registrar ENOM, INC.
Registrar IANA ID 48
Domain Status clientTransferProhibited
Registrant Organization WHOISGUARD, INC.
Registrant Street P.O. BOX 0823-03411
Registrant City PANAMA
Registrant State/Province PANAMA
Registrant Postal Code 00000
Registrant Country PA
Registrant Phone +507.8365503
Registrant Fax +51.17057182
Registrant Email 2A90119B4F16412B99E73B81F9400FE5.PROTECT [at] WHOISGUARD.COM
Admin Organization WHOISGUARD, INC.
Admin Street P.O. BOX 0823-03411
Admin City PANAMA
Admin State/Province PANAMA
Admin Postal Code 00000
Admin Country PA
Admin Phone +507.8365503
Admin Fax +51.17057182
Admin Email 2A90119B4F16412B99E73B81F9400FE5.PROTECT [at] WHOISGUARD.COM
Tech Organization WHOISGUARD, INC.
Tech Street P.O. BOX 0823-03411
Tech City PANAMA
Tech State/Province PANAMA
Tech Postal Code 00000
Tech Country PA
Tech Phone +507.8365503
Tech Fax +51.17057182
Tech Email 2A90119B4F16412B99E73B81F9400FE5.PROTECT [at] WHOISGUARD.COM
Registrar Abuse Contact Email abuse [at]
Registrar Abuse Contact Phone +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System

Domain hashes

CRC string 1334719084
Encrypted domain using STD DES rlG2CNv5G0mJI
Encrypted domain using CRYPT_EXT_DES _J9..70c8.EYl8zK/7G6
Encrypted domain using CRYPT_MD5 $1$70c83af3$1p.bwgL1KHuDtf7hD3ZMI1
Encrypted domain using Blowfish $2a$07$70c83af3ba4620876985fuNt4DcGD5uZUsiQAvoR7C/rZdxIe.3DW
Encrypted domain using SHA-256 $5$rounds=1000$70c83af3ba462087$ZoG2p8nkWUmV4zvqdlgBMatdCOZSuguex.CcR/j3zUA
Encrypted domain using SHA-512 $6$rounds=1000$70c83af3ba462087$rajEMGJZQ9h7N2tIr3C/Mu1uwg4R8cHICIVknz/wduLC1cOpBlmaiu7xVbLPSG2QHyW8UsfGVm.N3u38dkd.C/
Domain ascii representation 99 104 105 112 107 101 108 108 121 105 115 103 105 118 105 110 103 97 119 97 121 110 101 119 105 112 97 100 97 105 114 115 46 99 111 109 0
Domain ascii binary representation 1100011 1101000 1101001 1110000 1101011 1100101 1101100 1101100 1111001 1101001 1110011 1100111 1101001 1110110 1101001 1101110 1100111 1100001 1110111 1100001 1111001 1101110 1100101 1110111 1101001 1110000 1100001 1100100 1100001 1101001 1110010 1110011 101110 1100011 1101111 1101101 0 Mispellings

MispellingSimilarityLevenshtein distanceSoundex Metaphone Statistics

Relevant keywords

mansaadi 86%
mansaaf 92%
mansaaf eppendorf 52%
mansaaf hamburg 57%
mansaaf hamburg speisekarte 36%
mansaaf mittagstisch 46%
mansaaf speisekarte 48%
mansaaren ajot 60%
mansaaren ajot 2011 48%
mansaaren ajot 2013 48%
mansaaren ajot kuolleet 41%
mansaaren ajot videot 44%
mansaari 86%
mansaari ajot 63%
mansaari eu 71%
mansaari kartta 57%
mansaari matkailu 52%
mansaari sM-CM-$M-CM-$ 43%
mansaari tt 71%
mansaari tt 2012 55%
mansaari tt-ajot 55%
mansaari wiki 63%
mansaaya 86%

Buy your own domain

Buying a new domain name have never been easier. allows you to orientate yourself in world of domain name registrations. Our search tool provides you hundreds of available domain names, that can be registered on one click using our external partners. We allow you to discover domain name variants, that you could be searching for hours. Moreover, our tool gives you detailed data about every sinhle name variant, including traffic statistics for unregistered domain names (by providing DNS traffic data).

Last reviews