16-tools-for-responsive-web-design-part-1-grids-and-wireframe technical analysis

Free VPN - Free Anonymous OpenVPN Service

IP address

IP address: 77.236.192.200
Country: Czech Republic

Header

HTTP/1.1 200 OK
Date: Sat, 20 Feb 2016 07:29:07 GMT
Server: Apache
X-Powered-By: PHP/5.6.18
Vary: Accept-Encoding
Connection: close
Content-Type: text/html; charset=UTF-8

Basic information about 16-tools-for-responsive-web-design-part-1-grids-and-wireframe

Domain name length 61
Domain name length without TLD 61
TLD 16-tools-for-responsive-web-design-part-1-grids-and-wireframe
Abuse contact abuse [at] 16-tools-for-responsive-web-design-part-1-grids-and-wireframe
Reverse order emarferiw-dna-sdirg-1-trap-ngised-bew-evisnopser-rof-sloot-61
Sha256 Hash ecf5881375c0d47456629cc85abc3ca47279a234506e1afe6697f22bf1ec1b78
Domain MD5 Hash e097a52da22a7e0118b7ca4a4b221bdc
Metaphone TLSFRRSPNSFWBTSNPRTKRTSNTWRFRM
Soundex T421

16-tools-for-responsive-web-design-part-1-grids-and-wireframe Whois

Loading data...

Domain hashes

CRC string 884586608
Encrypted domain using STD DES rl0BKp8G3BO/o
Encrypted domain using CRYPT_EXT_DES _J9..70c8Dw7.coKxH52
Encrypted domain using CRYPT_MD5 $1$70c83af3$OWbJEuzJ0re1lbPwjMMKf0
Encrypted domain using Blowfish $2a$07$70c83af3ba4620876985fuhmf.757uuOGZSpzOgT1QGbqvf3v8K/q
Encrypted domain using SHA-256 $5$rounds=1000$70c83af3ba462087$.rgI5ca.giGDGqJ9iD2zxVvYkxskzyi3mQd8AiCyOuC
Encrypted domain using SHA-512 $6$rounds=1000$70c83af3ba462087$WUJy2Jl4LxRjpHFr79Uf1eT69.r5VzHhd7yvtp9GOQpdv7VYAbkNlu/a.IdkZVcfaXNd7M5i4yza9qikyIy/n0
Domain ascii representation 49 54 45 116 111 111 108 115 45 102 111 114 45 114 101 115 112 111 110 115 105 118 101 45 119 101 98 45 100 101 115 105 103 110 45 112 97 114 116 45 49 45 103 114 105 100 115 45 97 110 100 45 119 105 114 101 102 114 97 109 101 0
Domain ascii binary representation 110001 110110 101101 1110100 1101111 1101111 1101100 1110011 101101 1100110 1101111 1110010 101101 1110010 1100101 1110011 1110000 1101111 1101110 1110011 1101001 1110110 1100101 101101 1110111 1100101 1100010 101101 1100100 1100101 1110011 1101001 1100111 1101110 101101 1110000 1100001 1110010 1110100 101101 110001 101101 1100111 1110010 1101001 1100100 1110011 101101 1100001 1101110 1100100 101101 1110111 1101001 1110010 1100101 1100110 1110010 1100001 1101101 1100101 0

16-tools-for-responsive-web-design-part-1-grids-and-wireframe Mispellings

MispellingSimilarityLevenshtein distanceSoundex Metaphone Statistics
61-tools-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61-tools-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61toolsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61toolsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
1-6tools-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
1-6tools-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t-ools-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t-ools-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-otols-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62O342OTLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-otols-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61O342OTLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16otolsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52O342OTLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16otolsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51O342OTLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tolos-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tolos-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolosforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolosforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toosl-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T241TSLFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toosl-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T241TSLFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooslforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T241TSLFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooslforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T241TSLFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tool-sfor-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tool-sfor-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolsf-or-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolsf-or-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-ofr-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-ofr-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsofrresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsofrresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fro-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fro-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfroresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfroresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo-rresponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo-rresponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-forr-esponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-forr-esponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-ersponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-ersponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforersponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforersponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rseponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rseponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrseponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrseponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-repsonsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRPSNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-repsonsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRPSNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrepsonsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRPSNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrepsonsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRPSNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resopnsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resopnsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresopnsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresopnsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respnosive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respnosive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespnosivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespnosivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resposnive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPSNFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resposnive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPSNFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresposnivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPSNFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresposnivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPSNFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responisve-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responisve-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponisvewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponisvewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsvie-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsvie-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsviewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsviewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsiev-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsiev-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsievwebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsievwebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsiv-eweb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsiv-eweb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsivew-eb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsivew-eb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-ewb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-ewb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveewbdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveewbdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wbe-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wbe-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewbedesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewbedesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-we-bdesign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-we-bdesign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-webd-esign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-webd-esign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-edsign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-edsign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebedsignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebedsignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-dseign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-dseign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdseignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdseignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-deisgn-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-deisgn-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdeisgnpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdeisgnpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desgin-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desgin-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesginpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesginpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desing-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desing-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesingpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesingpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desig-npart-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-desig-npart-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-designp-art-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-designp-art-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-aprt-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-aprt-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignaprt1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignaprt1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-prat-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-prat-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignprat1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignprat1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-patr-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPTRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-patr-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPTRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpatr1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPTRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpatr1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPTRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-par-t1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-par-t1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part1--grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part1--grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part--1grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part--1grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1g-rids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1g-rids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-rgids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTRJTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-rgids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTRJTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1rgidsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTRJTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1rgidsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTRJTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-girds-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTJRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-girds-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTJRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1girdsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTJRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1girdsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTJRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grdis-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grdis-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1grdisandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1grdisandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grisd-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRSTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grisd-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRSTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1grisdandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRSTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1grisdandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRSTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grid-sand-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grid-sand-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-gridsa-nd-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-gridsa-nd-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-nad-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-nad-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsnadwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsnadwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-adn-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSTNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-adn-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSTNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsadnwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSTNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsadnwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSTNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-an-dwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-an-dwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-andw-ireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-andw-ireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-iwreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-iwreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandiwreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandiwreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wrieframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wrieframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwrieframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwrieframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wierframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wierframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwierframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwierframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirferame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirferame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirferame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirferame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirerfame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRRFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirerfame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRRFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirerfame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRRFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirerfame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRRFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefarme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefarme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefarme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefarme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrmae.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrmae16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrmae.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrmae16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefraem.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefraem16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefraem.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefraem16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-qeb-design-part-1-grids-and-qireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFKBTSNPRTKRTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-qeb-design-part-1-grids-and-qireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFKBTSNPRTKRTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveqebdesignpart1gridsandqireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFKBTSKNPRTKRTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveqebdesignpart1gridsandqireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFKBTSKNPRTKRTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-aeb-design-part-1-grids-and-aireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-aeb-design-part-1-grids-and-aireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveaebdesignpart1gridsandaireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveaebdesignpart1gridsandaireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-seb-design-part-1-grids-and-sireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFSBTSNPRTKRTSNTSRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-seb-design-part-1-grids-and-sireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFSBTSNPRTKRTSNTSRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivesebdesignpart1gridsandsireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFSBTSKNPRTKRTSNTSRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivesebdesignpart1gridsandsireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFSBTSKNPRTKRTSNTSRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-deb-design-part-1-grids-and-direframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFTBTSNPRTKRTSNTTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-deb-design-part-1-grids-and-direframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFTBTSNPRTKRTSNTTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivedebdesignpart1gridsanddireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFTBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivedebdesignpart1gridsanddireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFTBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-eeb-design-part-1-grids-and-eireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-eeb-design-part-1-grids-and-eireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveeebdesignpart1gridsandeireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsiveeebdesignpart1gridsandeireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-2eb-design-part-1-grids-and-2ireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-2eb-design-part-1-grids-and-2ireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsive2ebdesignpart1gridsand2ireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsive2ebdesignpart1gridsand2ireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-3eb-design-part-1-grids-and-3ireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-3eb-design-part-1-grids-and-3ireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsive3ebdesignpart1gridsand3ireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsive3ebdesignpart1gridsand3ireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rwsponsivw-wwb-dwsign-part-1-grids-and-wirwframw.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rwsponsivw-wwb-dwsign-part-1-grids-and-wirwframw16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrwsponsivwwwbdwsignpart1gridsandwirwframw.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrwsponsivwwwbdwsignpart1gridsandwirwframw16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rssponsivs-wsb-dssign-part-1-grids-and-wirsframs.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFSSBTSNPRTKRTSNTWRSFRMSTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rssponsivs-wsb-dssign-part-1-grids-and-wirsframs16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFSSBTSNPRTKRTSNTWRSFRMSTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrssponsivswsbdssignpart1gridsandwirsframs.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFSSBTSKNPRTKRTSNTWRSFRMSTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrssponsivswsbdssignpart1gridsandwirsframs16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFSSBTSKNPRTKRTSNTWRSFRMSTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rdsponsivd-wdb-ddsign-part-1-grids-and-wirdframd.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRTSPNSFTTBTSNPRTKRTSNTWRTFRMTTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rdsponsivd-wdb-ddsign-part-1-grids-and-wirdframd16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRTSPNSFTTBTSNPRTKRTSNTWRTFRMTTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrdsponsivdwdbddsignpart1gridsandwirdframd.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRTSPNSFTTBTSKNPRTKRTSNTWRTFRMTTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrdsponsivdwdbddsignpart1gridsandwirdframd16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRTSPNSFTTBTSKNPRTKRTSNTWRTFRMTTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rfsponsivf-wfb-dfsign-part-1-grids-and-wirfframf.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRFSPNSFFFBTFSNPRTKRTSNTWRFRMFTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rfsponsivf-wfb-dfsign-part-1-grids-and-wirfframf16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRFSPNSFFFBTFSNPRTKRTSNTWRFRMFTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrfsponsivfwfbdfsignpart1gridsandwirfframf.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRFSPNSFFFBTFSKNPRTKRTSNTWRFRMFTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrfsponsivfwfbdfsignpart1gridsandwirfframf16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRFSPNSFFFBTFSKNPRTKRTSNTWRFRMFTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rrsponsivr-wrb-drsign-part-1-grids-and-wirrframr.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFRRBTRSNPRTKRTSNTWRFRMRTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-rrsponsivr-wrb-drsign-part-1-grids-and-wirrframr16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFRRBTRSNPRTKRTSNTWRFRMRTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrrsponsivrwrbdrsignpart1gridsandwirrframr.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFRRBTRSKNPRTKRTSNTWRFRMRTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrrsponsivrwrbdrsignpart1gridsandwirrframr16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFRRBTRSKNPRTKRTSNTWRFRMRTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-r3sponsiv3-w3b-d3sign-part-1-grids-and-wir3fram3.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-r3sponsiv3-w3b-d3sign-part-1-grids-and-wir3fram316-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforr3sponsiv3w3bd3signpart1gridsandwir3fram3.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforr3sponsiv3w3bd3signpart1gridsandwir3fram316-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-r4sponsiv4-w4b-d4sign-part-1-grids-and-wir4fram4.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-r4sponsiv4-w4b-d4sign-part-1-grids-and-wir4fram416-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforr4sponsiv4w4bd4signpart1gridsandwir4fram4.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforr4sponsiv4w4bd4signpart1gridsandwir4fram416-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-foe-eesponsive-web-design-paet-1-geids-and-wieefeame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFSPNSFWBTSNPTJTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-foe-eesponsive-web-design-paet-1-geids-and-wieefeame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFSPNSFWBTSNPTJTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoeeesponsivewebdesignpaet1geidsandwieefeame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFSPNSFWBTSKNPTJTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoeeesponsivewebdesignpaet1geidsandwieefeame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFSPNSFWBTSKNPTJTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fod-desponsive-web-design-padt-1-gdids-and-widefdame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFTTSPNSFWBTSNPTTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fod-desponsive-web-design-padt-1-gdids-and-widefdame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFTTSPNSFWBTSNPTTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoddesponsivewebdesignpadt1gdidsandwidefdame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFTSPNSFWBTSKNPTTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoddesponsivewebdesignpadt1gdidsandwidefdame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFTSPNSFWBTSKNPTTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fof-fesponsive-web-design-paft-1-gfids-and-wifeffame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFFFSPNSFWBTSNPFTKFTSNTWFFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fof-fesponsive-web-design-paft-1-gfids-and-wifeffame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFFFSPNSFWBTSNPFTKFTSNTWFFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoffesponsivewebdesignpaft1gfidsandwifeffame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFFSPNSFWBTSKNPFTKFTSNTWFFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoffesponsivewebdesignpaft1gfidsandwifeffame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFFSPNSFWBTSKNPFTKFTSNTWFFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fog-gesponsive-web-design-pagt-1-ggids-and-wigefgame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFKJSPNSFWBTSNPKTKTSNTWJFKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fog-gesponsive-web-design-pagt-1-ggids-and-wigefgame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFKJSPNSFWBTSNPKTKTSNTWJFKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoggesponsivewebdesignpagt1ggidsandwigefgame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFKSPNSFWBTSKNPKTKTSNTWJFKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfoggesponsivewebdesignpagt1ggidsandwigefgame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFKSPNSFWBTSKNPKTKTSNTWJFKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fot-tesponsive-web-design-patt-1-gtids-and-witeftame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFTTSPNSFWBTSNPTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fot-tesponsive-web-design-patt-1-gtids-and-witeftame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFTTSPNSFWBTSNPTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfottesponsivewebdesignpatt1gtidsandwiteftame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFTSPNSFWBTSKNPTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfottesponsivewebdesignpatt1gtidsandwiteftame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFTSPNSFWBTSKNPTKTTSNTWTFTMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo4-4esponsive-web-design-pa4t-1-g4ids-and-wi4ef4ame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFSPNSFWBTSNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo4-4esponsive-web-design-pa4t-1-g4ids-and-wi4ef4ame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFSPNSFWBTSNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfo44esponsivewebdesignpa4t1g4idsandwi4ef4ame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFSPNSFWBTSKNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfo44esponsivewebdesignpa4t1g4idsandwi4ef4ame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFSPNSFWBTSKNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo5-5esponsive-web-design-pa5t-1-g5ids-and-wi5ef5ame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFSPNSFWBTSNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo5-5esponsive-web-design-pa5t-1-g5ids-and-wi5ef5ame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFSPNSFWBTSNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfo55esponsivewebdesignpa5t1g5idsandwi5ef5ame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFSPNSFWBTSKNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsfo55esponsivewebdesignpa5t1g5idsandwi5ef5ame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFSPNSFWBTSKNPTKTSNTWFMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-rools-for-responsive-web-design-parr-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62R421RLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-rools-for-responsive-web-design-parr-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61R421RLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16roolsforresponsivewebdesignparr1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52R421RLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16roolsforresponsivewebdesignparr1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51R421RLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-fools-for-responsive-web-design-parf-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62F421FLSFRRSPNSFWBTSNPRFKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-fools-for-responsive-web-design-parf-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61F421FLSFRRSPNSFWBTSNPRFKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16foolsforresponsivewebdesignparf1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52F421FLSFRSPNSFWBTSKNPRFKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16foolsforresponsivewebdesignparf1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51F421FLSFRSPNSFWBTSKNPRFKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-gools-for-responsive-web-design-parg-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62G421KLSFRRSPNSFWBTSNPRKKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-gools-for-responsive-web-design-parg-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61G421KLSFRRSPNSFWBTSNPRKKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16goolsforresponsivewebdesignparg1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52G421KLSFRSPNSFWBTSKNPRKKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16goolsforresponsivewebdesignparg1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51G421KLSFRSPNSFWBTSKNPRKKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-hools-for-responsive-web-design-parh-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62H421HLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-hools-for-responsive-web-design-parh-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61H421HLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16hoolsforresponsivewebdesignparh1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52H421HLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16hoolsforresponsivewebdesignparh1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51H421HLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-yools-for-responsive-web-design-pary-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62Y421YLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-yools-for-responsive-web-design-pary-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61Y421YLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16yoolsforresponsivewebdesignpary1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52Y421YLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16yoolsforresponsivewebdesignpary1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51Y421YLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-5ools-for-responsive-web-design-par5-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62O421OLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-5ools-for-responsive-web-design-par5-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61O421OLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
165oolsforresponsivewebdesignpar51gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52O421OLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
165oolsforresponsivewebdesignpar51gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51O421OLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-6ools-for-responsive-web-design-par6-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62O421OLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-6ools-for-responsive-web-design-par6-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61O421OLSFRRSPNSFWBTSNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
166oolsforresponsivewebdesignpar61gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52O421OLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
166oolsforresponsivewebdesignpar61gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51O421OLSFRSPNSFWBTSKNPRKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsuve-web-desugn-part-1-gruds-and-wureframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsuve-web-desugn-part-1-gruds-and-wureframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsuvewebdesugnpart1grudsandwureframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsuvewebdesugnpart1grudsandwureframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsjve-web-desjgn-part-1-grjds-and-wjreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSJFWBTSJNPRTKRJTSNTJRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsjve-web-desjgn-part-1-grjds-and-wjreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSJFWBTSJNPRTKRJTSNTJRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsjvewebdesjgnpart1grjdsandwjreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSJFWBTSJKNPRTKRJTSNTJRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsjvewebdesjgnpart1grjdsandwjreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSJFWBTSJKNPRTKRJTSNTJRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responskve-web-deskgn-part-1-grkds-and-wkreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSKFWBTSKNPRTKRKTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responskve-web-deskgn-part-1-grkds-and-wkreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSKFWBTSKNPRTKRKTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponskvewebdeskgnpart1grkdsandwkreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSKFWBTSKKNPRTKRKTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponskvewebdeskgnpart1grkdsandwkreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSKFWBTSKKNPRTKRKTSNTKRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responslve-web-deslgn-part-1-grlds-and-wlreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSLFWBTSLNPRTKRLTSNTLRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responslve-web-deslgn-part-1-grlds-and-wlreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSLFWBTSLNPRTKRLTSNTLRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponslvewebdeslgnpart1grldsandwlreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSLFWBTSLKNPRTKRLTSNTLRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponslvewebdeslgnpart1grldsandwlreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSLFWBTSLKNPRTKRLTSNTLRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsove-web-desogn-part-1-grods-and-woreframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsove-web-desogn-part-1-grods-and-woreframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsovewebdesognpart1grodsandworeframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsovewebdesognpart1grodsandworeframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respons8ve-web-des8gn-part-1-gr8ds-and-w8reframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respons8ve-web-des8gn-part-1-gr8ds-and-w8reframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespons8vewebdes8gnpart1gr8dsandw8reframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespons8vewebdes8gnpart1gr8dsandw8reframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respons9ve-web-des9gn-part-1-gr9ds-and-w9reframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respons9ve-web-des9gn-part-1-gr9ds-and-w9reframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespons9vewebdes9gnpart1gr9dsandw9reframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespons9vewebdes9gnpart1gr9dsandw9reframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tiils-fir-respinsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tiils-fir-respinsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tiilsfirrespinsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tiilsfirrespinsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tkkls-fkr-respknsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T242TKLSFKRRSPKNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tkkls-fkr-respknsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T242TKLSFKRRSPKNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tkklsfkrrespknsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T242TKLSFKRSPKNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tkklsfkrrespknsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T242TKLSFKRSPKNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tllls-flr-resplnsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFLRRSPLNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tllls-flr-resplnsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFLRRSPLNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tlllsflrresplnsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFLRSPLNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tlllsflrresplnsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFLRSPLNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-t99ls-f9r-resp9nsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-t99ls-f9r-resp9nsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t99lsf9rresp9nsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t99lsf9rresp9nsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-t00ls-f0r-resp0nsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-t00ls-f0r-resp0nsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t00lsf0rresp0nsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t00lsf0rresp0nsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resoonsive-web-design-oart-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-resoonsive-web-design-oart-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresoonsivewebdesignoart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSNSFWBTSKNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresoonsivewebdesignoart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSNSFWBTSKNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-reslonsive-web-design-lart-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSLNSFWBTSNLRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-reslonsive-web-design-lart-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSLNSFWBTSNLRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforreslonsivewebdesignlart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSLNSFWBTSKNLRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforreslonsivewebdesignlart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSLNSFWBTSKNLRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-res0onsive-web-design-0art-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-res0onsive-web-design-0art-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforres0onsivewebdesign0art1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforres0onsivewebdesign0art1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSNSFWBTSNRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pqrt-1-grids-qnd-wirefrqme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPKRTKRTSKNTWRFRKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pqrt-1-grids-qnd-wirefrqme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPKRTKRTSKNTWRFRKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpqrt1gridsqndwirefrqme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPKRTKRTSKNTWRFRKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpqrt1gridsqndwirefrqme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPKRTKRTSKNTWRFRKMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pwrt-1-grids-wnd-wirefrwme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pwrt-1-grids-wnd-wirefrwme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpwrt1gridswndwirefrwme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpwrt1gridswndwirefrwme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-psrt-1-grids-snd-wirefrsme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-psrt-1-grids-snd-wirefrsme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpsrt1gridssndwirefrsme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPSRTKRTSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpsrt1gridssndwirefrsme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPSRTKRTSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pxrt-1-grids-xnd-wirefrxme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPKSRTKRTSKSNTWRFRKSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pxrt-1-grids-xnd-wirefrxme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPKSRTKRTSKSNTWRFRKSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpxrt1gridsxndwirefrxme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPKSRTKRTSKSNTWRFRKSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpxrt1gridsxndwirefrxme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPKSRTKRTSKSNTWRFRKSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pzrt-1-grids-znd-wirefrzme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-pzrt-1-grids-znd-wirefrzme16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpzrt1gridszndwirefrzme.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpzrt1gridszndwirefrzme16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPSRTKRTSSNTWRFRSMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolq-for-reqponqive-web-deqign-part-1-gridq-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLKFRRKPNKFWBTKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolq-for-reqponqive-web-deqign-part-1-gridq-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLKFRRKPNKFWBTKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolqforreqponqivewebdeqignpart1gridqandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLKFRKPNKFWBTKKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolqforreqponqivewebdeqignpart1gridqandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLKFRKPNKFWBTKKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolw-for-rewponwive-web-dewign-part-1-gridw-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T416TLFRRPNWFWBTWNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolw-for-rewponwive-web-dewign-part-1-gridw-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T416TLFRRPNWFWBTWNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolwforrewponwivewebdewignpart1gridwandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T416TLFRPNWFWBTWKNPRTKRTWNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolwforrewponwivewebdewignpart1gridwandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T416TLFRPNWFWBTWKNPRTKRTWNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toole-for-reeponeive-web-deeign-part-1-gride-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T416TLFRRPNFWBTNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toole-for-reeponeive-web-deeign-part-1-gride-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T416TLFRRPNFWBTNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooleforreeponeivewebdeeignpart1grideandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T416TLFRPNFWBTKNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooleforreeponeivewebdeeignpart1grideandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T416TLFRPNFWBTKNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toold-for-redpondive-web-dedign-part-1-gridd-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T431TLTFRRTPNTFWBTTNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toold-for-redpondive-web-dedign-part-1-gridd-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T431TLTFRRTPNTFWBTTNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooldforredpondivewebdedignpart1griddandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T431TLTFRTPNTFWBTTKNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooldforredpondivewebdedignpart1griddandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T431TLTFRTPNTFWBTTKNPRTKRTNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolc-for-recponcive-web-decign-part-1-gridc-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLKFRRKPNSFWBTSNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolc-for-recponcive-web-decign-part-1-gridc-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLKFRRKPNSFWBTSNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolcforrecponcivewebdecignpart1gridcandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLKFRKPNSFWBTSKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolcforrecponcivewebdecignpart1gridcandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLKFRKPNSFWBTSKNPRTKRTKNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolx-for-rexponxive-web-dexign-part-1-gridx-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLKSFRRKSPNKSFWBTKSNPRTKRTKSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolx-for-rexponxive-web-dexign-part-1-gridx-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLKSFRRKSPNKSFWBTKSNPRTKRTKSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolxforrexponxivewebdexignpart1gridxandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLKSFRKSPNKSFWBTKSKNPRTKRTKSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolxforrexponxivewebdexignpart1gridxandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLKSFRKSPNKSFWBTKSKNPRTKRTKSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolz-for-rezponzive-web-dezign-part-1-gridz-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toolz-for-rezponzive-web-dezign-part-1-gridz-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolzforrezponzivewebdezignpart1gridzandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolzforrezponzivewebdezignpart1gridzandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-wesign-part-1-griws-anw-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBWSNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-wesign-part-1-griws-anw-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBWSNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebwesignpart1griwsanwwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBWSKNPRTKRSNRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebwesignpart1griwsanwwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBWSKNPRTKRSNRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-sesign-part-1-griss-ans-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBSSNPRTKRSNSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-sesign-part-1-griss-ans-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBSSNPRTKRSNSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebsesignpart1grissanswireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBSSKNPRTKRSNSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebsesignpart1grissanswireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBSSKNPRTKRSNSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-xesign-part-1-grixs-anx-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBKSSNPRTKRKSSNKSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-xesign-part-1-grixs-anx-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBKSSNPRTKRKSSNKSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebxesignpart1grixsanxwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBKSSKNPRTKRKSSNKSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebxesignpart1grixsanxwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBKSSKNPRTKRKSSNKSWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-cesign-part-1-grics-anc-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBSSNPRTKRKSNKWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-cesign-part-1-grics-anc-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBSSNPRTKRKSNKWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebcesignpart1gricsancwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBSSKNPRTKRKSNKWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebcesignpart1gricsancwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBSSKNPRTKRKSNKWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-vesign-part-1-grivs-anv-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBFSNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-vesign-part-1-grivs-anv-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBFSNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebvesignpart1grivsanvwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBFSKNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebvesignpart1grivsanvwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBFSKNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-fesign-part-1-grifs-anf-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBFSNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-fesign-part-1-grifs-anf-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBFSNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebfesignpart1grifsanfwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBFSKNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebfesignpart1grifsanfwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBFSKNPRTKRFSNFWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-resign-part-1-grirs-anr-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBRSNPRTKRRSNRWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-resign-part-1-grirs-anr-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBRSNPRTKRRSNRWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebresignpart1grirsanrwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBRSKNPRTKRRSNRWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebresignpart1grirsanrwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBRSKNPRTKRRSNRWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-eesign-part-1-gries-ane-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBSNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-eesign-part-1-gries-ane-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBSNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebeesignpart1griesanewireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBSKNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebeesignpart1griesanewireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBSKNPRTKRSNWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-eor-responsive-web-design-part-1-grids-and-wireerame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T426TLSRRSPNSFWBTSNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-eor-responsive-web-design-part-1-grids-and-wireerame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T426TLSRRSPNSFWBTSNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolseorresponsivewebdesignpart1gridsandwireerame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T426TLSRSPNSFWBTSKNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolseorresponsivewebdesignpart1gridsandwireerame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T426TLSRSPNSFWBTSKNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-dor-responsive-web-design-part-1-grids-and-wiredrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T423TLSTRRSPNSFWBTSNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-dor-responsive-web-design-part-1-grids-and-wiredrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T423TLSTRRSPNSFWBTSNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsdorresponsivewebdesignpart1gridsandwiredrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T423TLSTRSPNSFWBTSKNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsdorresponsivewebdesignpart1gridsandwiredrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T423TLSTRSPNSFWBTSKNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-cor-responsive-web-design-part-1-grids-and-wirecrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T426TLSKRRSPNSFWBTSNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-cor-responsive-web-design-part-1-grids-and-wirecrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T426TLSKRRSPNSFWBTSNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolscorresponsivewebdesignpart1gridsandwirecrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T426TLSKRSPNSFWBTSKNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolscorresponsivewebdesignpart1gridsandwirecrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T426TLSKRSPNSFWBTSKNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-vor-responsive-web-design-part-1-grids-and-wirevrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-vor-responsive-web-design-part-1-grids-and-wirevrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsvorresponsivewebdesignpart1gridsandwirevrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsvorresponsivewebdesignpart1gridsandwirevrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-gor-responsive-web-design-part-1-grids-and-wiregrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T426TLSKRRSPNSFWBTSNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-gor-responsive-web-design-part-1-grids-and-wiregrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T426TLSKRRSPNSFWBTSNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsgorresponsivewebdesignpart1gridsandwiregrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T426TLSKRSPNSFWBTSKNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsgorresponsivewebdesignpart1gridsandwiregrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T426TLSKRSPNSFWBTSKNPRTKRTSNTWRKRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-tor-responsive-web-design-part-1-grids-and-wiretrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T423TLSTRRSPNSFWBTSNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-tor-responsive-web-design-part-1-grids-and-wiretrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T423TLSTRRSPNSFWBTSNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolstorresponsivewebdesignpart1gridsandwiretrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T423TLSTRSPNSFWBTSKNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolstorresponsivewebdesignpart1gridsandwiretrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T423TLSTRSPNSFWBTSKNPRTKRTSNTWRTRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-ror-responsive-web-design-part-1-grids-and-wirerrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T426TLSRRRSPNSFWBTSNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-ror-responsive-web-design-part-1-grids-and-wirerrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T426TLSRRRSPNSFWBTSNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsrorresponsivewebdesignpart1gridsandwirerrame.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T426TLSRRSPNSFWBTSKNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsrorresponsivewebdesignpart1gridsandwirerrame16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T426TLSRRSPNSFWBTSKNPRTKRTSNTWRRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooos-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T216TSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooos-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T216TSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooosforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T216TSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooosforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T216TSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toops-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T121TPSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-toops-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T121TPSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toopsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T121TPSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toopsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T121TPSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooks-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T216TKSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooks-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T216TKSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooksforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T216TKSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tooksforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T216TKSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooms-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T521TMSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tooms-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T521TMSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toomsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T521TMSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toomsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T521TMSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsice-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSSWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsice-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSSWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsicewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSSWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsicewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSSWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsife-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsife-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsifewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsifewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsige-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSJWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsige-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSJWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsigewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSJWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsigewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSJWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsibe-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSBWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsibe-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSBWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsibewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSBWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsibewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSBWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wev-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWFTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wev-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWFTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewevdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWFTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewevdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWFTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-weg-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWKTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-weg-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWKTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewegdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWKTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewegdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWKTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-weh-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-weh-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewehdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewehdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wen-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWNTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-wen-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWNTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewendesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWNTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewendesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWNTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respobsive-web-desigb-part-1-grids-abd-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPBSFWBTSKBPRTKRTSBTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respobsive-web-desigb-part-1-grids-abd-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPBSFWBTSKBPRTKRTSBTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespobsivewebdesigbpart1gridsabdwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPBSFWBTSKBPRTKRTSBTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespobsivewebdesigbpart1gridsabdwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPBSFWBTSKBPRTKRTSBTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respohsive-web-desigh-part-1-grids-ahd-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPSFWBTSFPRTKRTSTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respohsive-web-desigh-part-1-grids-ahd-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPSFWBTSFPRTKRTSTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespohsivewebdesighpart1gridsahdwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPSFWBTSFPRTKRTSTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespohsivewebdesighpart1gridsahdwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPSFWBTSFPRTKRTSTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respojsive-web-desigj-part-1-grids-ajd-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPJSFWBTSKJPRTKRTSJTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respojsive-web-desigj-part-1-grids-ajd-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPJSFWBTSKJPRTKRTSJTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespojsivewebdesigjpart1gridsajdwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPJSFWBTSKJPRTKRTSJTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespojsivewebdesigjpart1gridsajdwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPJSFWBTSKJPRTKRTSJTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respomsive-web-desigm-part-1-grids-amd-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPMSFWBTSKMPRTKRTSMTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-respomsive-web-desigm-part-1-grids-amd-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPMSFWBTSKMPRTKRTSMTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespomsivewebdesigmpart1gridsamdwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPMSFWBTSKMPRTKRTSMTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforrespomsivewebdesigmpart1gridsamdwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPMSFWBTSKMPRTKRTSMTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrane.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRNTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrane16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRNTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrane.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRNTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrane16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRNTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefraje.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRJTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefraje16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRJTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefraje.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRJTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefraje16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRJTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrake.16-tools-for-responsive-web-design-part-1-grids-and-wireframe66%
62T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRKTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-responsive-web-design-part-1-grids-and-wirefrake16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRKTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrake.16-tools-for-responsive-web-design-part-1-grids-and-wireframe70%
52T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRKTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforresponsivewebdesignpart1gridsandwirefrake16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRKTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61-tols-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61-tols-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61tolsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
61tolsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
1-6tols-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
1-6tols-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t-ols-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16t-ols-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tosl-for-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T241TSLFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tosl-for-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T241TSLFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toslforresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T241TSLFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toslforresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T241TSLFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tol-sfor-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tol-sfor-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tolsf-or-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tolsf-or-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-ofr-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-ofr-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsofrresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsofrresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-fro-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-fro-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsfroresponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsfroresponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-fo-rresponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-fo-rresponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo-responsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-fo-responsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforesponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16toolsforesponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-forr-esponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-forr-esponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-esponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tools-for-esponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-ersponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-ersponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforersponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforersponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-rseponsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-rseponsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrseponsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrseponsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-repsonsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRPSNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-repsonsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRPSNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrepsonsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRPSNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrepsonsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRPSNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-resopnsive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-resopnsive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresopnsivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresopnsivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-respnosive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-respnosive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrespnosivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforrespnosivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-resposnive-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPSNFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-resposnive-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPSNFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresposnivewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPSNFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresposnivewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPSNFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responisve-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responisve-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponisvewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponisvewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsvie-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsvie-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsviewebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsviewebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsiev-web-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsiev-web-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsievwebdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsievwebdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsiv-eweb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsiv-eweb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsivew-eb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsivew-eb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-ewb-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-ewb-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsiveewbdesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsiveewbdesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-wbe-design-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-wbe-design-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewbedesignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewbedesignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-we-bdesign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-we-bdesign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-webd-esign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-webd-esign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-edsign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-edsign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebedsignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebedsignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-dseign-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-dseign-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdseignpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdseignpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-deisgn-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-deisgn-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdeisgnpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdeisgnpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desgin-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desgin-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesginpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesginpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSJNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desing-part-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desing-part-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesingpart1gridsandwireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
51T421TLSFRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16tolsforresponsivewebdesingpart1gridsandwireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe71%
50T421TLSFRSPNSFWBTSNKPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desig-npart-1-grids-and-wireframe.16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
61T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM DT A D M
16-tols-for-responsive-web-desig-npart-1-grids-and-wireframe16-tools-for-responsive-web-design-part-1-grids-and-wireframe67%
60T421TLSFRRSPNSFWBTSKNPRTKRTSNTWRFRMTLSFRRSPNSFWBTSNPRTKRTSNTWRFRM